DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and HDG3

DIOPT Version :10

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_180796.2 Gene:HDG3 / 817798 AraportID:AT2G32370 Length:725 Species:Arabidopsis thaliana


Alignment Length:137 Identity:39/137 - (28%)
Similarity:62/137 - (45%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EELPDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRR 150
            |.|.::...|..::.....|..||:|:|..|.:..:....:..||||:|.|...|:|.||:|:|.
plant    57 EGLGNNQAPRHKKKKYNRHTQLQISEMEAFFRECPHPDDKQRYDLSAQLGLDPVQIKFWFQNKRT 121

  Fly   151 RHKIQSDQHKDQSYEGMPLSPGMKQSDGDPPSLQTLSLGGGATPNALTPSPTPSTPTAHMT--EH 213
            ::|.|  |.:.::.|...|:..::..:      |.|.   .|...||.|.....|....||  ||
plant   122 QNKNQ--QERFENSELRNLNNHLRSEN------QRLR---EAIHQALCPKCGGQTAIGEMTFEEH 175

  Fly   214 YSESFNA 220
            :....||
plant   176 HLRILNA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeodomain 106..153 CDD:459649 17/46 (37%)
HDG3NP_180796.2 Homeodomain 69..125 CDD:459649 18/55 (33%)
ClpA <119..>206 CDD:440308 19/75 (25%)
START_ArGLABRA2_like 247..471 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.