DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bcd and HOXA5

DIOPT Version :10

Sequence 1:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:103 Identity:34/103 - (33%)
Similarity:53/103 - (51%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PNQMP--KPDVFP-SEEL---PDSLVMRRPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSA 132
            |:..|  :|.::| ..:|   .|::.....:|.||.:|..|..|||:.|...||||..|..:::.
Human   166 PSPAPPAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAH 230

  Fly   133 KLALGTAQVKIWFKNRRRRHKIQSDQHKDQSYEGMPLS 170
            .|.|...|:||||:|||.:.|      ||...:.|.::
Human   231 ALCLSERQIKIWFQNRRMKWK------KDNKLKSMSMA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bcdNP_788587.1 Homeodomain 106..153 CDD:459649 20/46 (43%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 2/8 (25%)
Antp-type hexapeptide 176..181 1/4 (25%)
Homeodomain 196..252 CDD:459649 25/61 (41%)

Return to query results.
Submit another query.