DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen and zen2

Sequence 1:NP_476793.1 Gene:zen FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster

Alignment Length:238 Identity:81/239 (34%)
Similarity:111/239 (46%) Gaps:57/239 (24%)


  Fly    75 ENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQ 139
            |..|:.....|:  |.|||||||:|:||:|||.||..|.||.|||||||:|||:|.|||||||||
  Fly    30 EAAPTATTRSSE--KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQ 92

  Fly   140 NRRMKFKKDIQGHREPKSNAK-------LAQPQAEQSAH-----RGIVKRLMSYSQDP------- 185
            |||||.||        .:|.|       .:.|.:.||:.     ..||:||:.|:...       
  Fly    93 NRRMKLKK--------STNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLR 149

  Fly   186 -------REGTAAA---------EKRPMMAVAPVNPKPDYQASQKMKTEASTNNGMCSSADLSE- 233
                   .||....         |..|.....|..|..::.|:.     ||:..|:..:..::| 
  Fly   150 QVDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANW-----ASSWLGLEPTIPIAEN 209

  Fly   234 ILEHLAQTTAAPQVSTATSSTGTSTNSASSSSSGHYSYNVDLV 276
            ::||  .|...|.:....    ..:||:|:|||.....:.|.:
  Fly   210 VIEH--NTQDQPMIQNFC----WDSNSSSASSSDILDVDYDFI 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 41/53 (77%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 41/53 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258718841
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45664
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.