DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen and Gem2

Sequence 1:NP_476793.1 Gene:zen FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001262034.1 Gene:Gem2 FlyBaseID:FBgn0036850 Length:245 Species:Drosophila melanogaster

Alignment Length:38 Identity:10/39 (26%)
Similarity:17/39 (44%) Gaps:5/39 (13%)


  Fly    77 LPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMY 114
            ||:....|.|....:.:|:     |::.|..|..:|.|
  Fly    82 LPTPEWRDEQVKSFQAARS-----QVLVLRKELANNNY 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 6/23 (26%)
Gem2NP_001262034.1 SIP1 18..239 CDD:282754 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3221
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.