DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen and unpg

Sequence 1:NP_476793.1 Gene:zen FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:281 Identity:78/282 (28%)
Similarity:103/282 (37%) Gaps:97/282 (34%)


  Fly    11 HQAKVGSYSAD-------------PSEVKYSDLIYGHHHDVNP---IGL---------------- 43
            |.|..|....|             |.:...|....|.|..:.|   :|:                
  Fly   197 HMAAAGRMHEDQANPGMAQLQEPTPPQAHSSPAKSGSHSPMEPALDVGMDEDFECSGDSCSDISL 261

  Fly    44 ---PPNYN----------QMNSNPTTLNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRT 95
               |.|||          ..||:....:|....|..|:......::  ||.|..|...|.:|.||
  Fly   262 TMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGAQSRHEGGGMGGKD--SQGNGSSSNSKSRRRRT 324

  Fly    96 AFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQ--------GH 152
            ||||.||:|||.||.:..||..|.|.:||..|.|.|.||||||||||.|:|: ::        |.
  Fly   325 AFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR-VKAGLTSHGLGR 388

  Fly   153 REPKSNAKLAQP-------QAEQSAHRGIVKRLMSYSQDPREGTAAAEKRPMMAVAPVNPKPDYQ 210
            ....|..|:..|       .|.:|.|:.:.|..:|                       .||||.:
  Fly   389 NGTTSGTKIVVPIPVHVNRFAVRSQHQQLEKMCLS-----------------------GPKPDLR 430

  Fly   211 ASQKMKTEA---------STN 222
              :|:..||         |||
  Fly   431 --KKLSAEAIGGFEKFSGSTN 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeobox 93..146 CDD:278475 33/53 (62%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.