DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXA3

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_109377.1 Gene:HOXA3 / 3200 HGNCID:5104 Length:443 Species:Homo sapiens


Alignment Length:139 Identity:59/139 - (42%)
Similarity:72/139 - (51%) Gaps:35/139 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PIGLPPNYNQMNSNPTTLNDHCSP-------------------QHVHQQHVSS--------DENL 77
            |....|..|..| |||..|...||                   |:..|:..||        |::.
Human   122 PSSASPPQNASN-NPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCAGDKSP 185

  Fly    78 PSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRR 142
            |.|.:.       ||:|||:||.||||||.||..|.||.|.||:|:|..|:|.|||:||||||||
Human   186 PGQASS-------KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRR 243

  Fly   143 MKFKKDIQG 151
            ||:|||.:|
Human   244 MKYKKDQKG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 38/55 (69%)
HOXA3NP_109377.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..147 10/25 (40%)
Antp-type hexapeptide 155..160 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 9/43 (21%)
Homeodomain 192..248 CDD:459649 38/55 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..338 4/6 (67%)
DUF4074 377..441 CDD:463833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.