DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and HOXA1

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_005513.2 Gene:HOXA1 / 3198 HGNCID:5099 Length:335 Species:Homo sapiens


Alignment Length:223 Identity:69/223 - (30%)
Similarity:93/223 - (41%) Gaps:61/223 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSVMHYYPVHQAKVGSYSADPSEVKYSDLIYGHHHDVNPIGLPPNYNQMNSNPTTLNDHCSPQHV 66
            |.::.::..||...|.....|..:.:|   ||..|....:             .|.|:..||.|.
Human   137 SPMVQHHHHHQGYAGGAVGSPQYIHHS---YGQEHQSLAL-------------ATYNNSLSPLHA 185

  Fly    67 -HQQHVSSDENLPSQPNHDSQRVKLKRS-------------------RTAFTSVQLVELENEFKS 111
             ||:...|..:..|.|......:|:||:                   ||.||:.||.|||.||..
Human   186 SHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHF 250

  Fly   112 NMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHRE-----------PKSNAKLAQPQ 165
            |.||.|.||:|||..|.|.|.||||||||||||.||     ||           |..|.:.|:..
Human   251 NKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKK-----REKEGLLPISPATPPGNDEKAEES 310

  Fly   166 AEQSAHRGIVKRLMSYSQDPREGTAAAE 193
            :|:|:....|         |..|::.::
Human   311 SEKSSSSPCV---------PSPGSSTSD 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 37/74 (50%)
HOXA1NP_005513.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..80
Interaction with OGT. /evidence=ECO:0000250|UniProtKB:P09022 75..203 19/81 (23%)
COG5576 176..>286 CDD:227863 47/109 (43%)
Antp-type hexapeptide 204..209 0/4 (0%)
Homeodomain 233..286 CDD:459649 35/52 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..335 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.