DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen and Hoxc12

DIOPT Version :10

Sequence 1:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001100266.1 Gene:Hoxc12 / 300262 RGDID:1310539 Length:280 Species:Rattus norvegicus


Alignment Length:75 Identity:35/75 - (46%)
Similarity:46/75 - (61%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIW 137
            |....|..|.|...|.|    |..::.:||.|||.||..|.::.|.||.|::.||:|.::|||||
  Rat   199 SASGAPWYPIHSRSRKK----RKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIW 259

  Fly   138 FQNRRMKFKK 147
            |||||||.|:
  Rat   260 FQNRRMKKKR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zenNP_476793.1 Homeodomain 91..147 CDD:459649 28/55 (51%)
Hoxc12NP_001100266.1 Homeodomain 213..269 CDD:459649 30/59 (51%)

Return to query results.
Submit another query.