DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and HAT1

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana

Alignment Length:147 Identity:36/148 (24%)
Similarity:65/148 (44%) Gaps:26/148 (18%)


  Fly    25 VELNVEAAPTATTRSSEKSKRSRTAFSSLQLIE-----LEREFHLNKYLARTRRIEISQRLALTE 84
            :::.::.:.:..|...|:.....|....|:|.:     ||..|..:..|...:::.::::|.||.
plant   109 LDITLDRSSSRGTSDEEEDYGGETCRKKLRLSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTA 173

  Fly    85 RQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNV--ETAP 147
            |||::||||||.:.|                  ..|:..|.:...:.||:|.. .|..:  |.|.
plant   174 RQVEVWFQNRRARTK------------------LKQTEVDCEYLKRCVEKLTE-ENRRLEKEAAE 219

  Fly   148 LRQVDHGVLEEGQITPP 164
            ||.:.......||::||
plant   220 LRALKLSPRLYGQMSPP 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 19/58 (33%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474
HOX 134..188 CDD:197696 18/54 (33%)
HALZ 190..233 CDD:128634 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.