DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HB4

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_182018.1 Gene:HB4 / 819100 AraportID:AT2G44910 Length:318 Species:Arabidopsis thaliana


Alignment Length:55 Identity:19/55 - (34%)
Similarity:32/55 - (58%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK 99
            |.:...|..|.:.||..|..:..|...:::.::::|.|..|||::||||||.:.|
plant   162 RKKLRLSKDQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 19/55 (35%)
HB4NP_182018.1 HD-ZIP_N 8..124 CDD:461370
Homeodomain 162..216 CDD:459649 18/53 (34%)
HALZ 218..261 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.