DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxd9

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001166940.1 Gene:Hoxd9 / 688999 RGDID:1582908 Length:343 Species:Rattus norvegicus


Alignment Length:73 Identity:36/73 - (49%)
Similarity:49/73 - (67%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97
            |.|....:..:::.|..::..|.:|||:||..|.||.|.||.|:::.|.||||||||||||||||
  Rat   266 PAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMK 330

  Fly    98 LKKSTNRK 105
            :||.:..|
  Rat   331 MKKMSKEK 338

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 31/55 (56%)
Hoxd9NP_001166940.1 Hox9_act 1..>155 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..196