DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and hoxc1a

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio

Alignment Length:95 Identity:51/96 (53%)
Similarity:61/96 (64%) Gaps:8/96 (8%)


  Fly    38 RSSEK---SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK 99
            |.|::   |..|||.|::.||.|||:|||.||||.|.|||||:..|.|:|.||||||||||||.|
Zfish   207 RDSDEDTSSGGSRTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIWFQNRRMKQK 271

  Fly   100 KSTNRKGAIGALTTSIPLSSQSSEDLQKDD 129
            |.. |:|    |...:.|.|...||.:|.|
Zfish   272 KML-REG----LAQGLMLISGCDEDSKKSD 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 37/53 (70%)
hoxc1aNP_571606.1 Homeobox 218..271 CDD:278475 37/53 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.