DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and gsx2

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001017168.1 Gene:gsx2 XenbaseID:XB-GENE-492505 Length:248 Species:Xenopus tropicalis

Alignment Length:94 Identity:48/95 (51%)
Similarity:63/95 (66%) Gaps:7/95 (7%)


  Fly    14 YSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQ 78
            |:|:|...:.|:.:.     .|....::..||.||||||.||:||||||..|.||:|.|||||:.
 Frog   122 YNVTDPRRFHCMTMG-----GAENSQAQNGKRMRTAFSSTQLLELEREFSSNMYLSRLRRIEIAT 181

  Fly    79 RLALTERQVKIWFQNRRMKLKKSTNRKGA 107
            .|:|:|:||||||||||:|.||  ..||:
 Frog   182 YLSLSEKQVKIWFQNRRVKHKK--ENKGS 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 37/53 (70%)
gsx2NP_001017168.1 Homeobox 150..202 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258681202
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.