DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and HGTX

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster


Alignment Length:59 Identity:27/59 - (45%)
Similarity:37/59 - (62%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK 100
            |.|.:|..||..|:..||:.|...||||...|.:::..|.::|.|||:||||||.|.:|
  Fly   465 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 25/55 (45%)
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeodomain 465..523 CDD:459649 26/57 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.