DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and gbx2.2

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001011472.1 Gene:gbx2.2 XenbaseID:XB-GENE-852624 Length:340 Species:Xenopus tropicalis

Alignment Length:73 Identity:39/74 (53%)
Similarity:52/74 (70%) Gaps:0/74 (0%)


  Fly    28 NVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQ 92
            |...:..:.|.|:.|::|.||||:|.||:|||:|||..|||:.|.|.:|:..|.|:|.|||||||
 Frog   224 NSNPSNNSNTSSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHVLKLSEVQVKIWFQ 288

  Fly    93 NRRMKLKK 100
            |||.|.|:
 Frog   289 NRRAKWKR 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/53 (62%)
gbx2.2NP_001011472.1 Homeobox 242..295 CDD:278475 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.