DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and btn

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_732768.1 Gene:btn FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster

Alignment Length:119 Identity:51/120 (43%)
Similarity:64/120 (53%) Gaps:23/120 (19%)


  Fly     5 QSENY----FVDNYSVSD-------LMMYPCVELNVE----AAPTATTRSSEKSK--------RS 46
            |:|.|    :|.::|.|.       |....|.|.|.:    .|||.....|::||        :.
  Fly    25 QTEGYTDCSYVYDHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKE 89

  Fly    47 RTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK 100
            |||||..||.:||.||..:.||.|.||.||:..|.|||||||:||||||||.|:
  Fly    90 RTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/53 (64%)
btnNP_732768.1 Homeobox 90..142 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.