DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and abd-A

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_732176.1 Gene:abd-A FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster

Alignment Length:152 Identity:51/153 (33%)
Similarity:74/153 (48%) Gaps:34/153 (22%)


  Fly    16 VSDLMMYP----------------CVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHL 64
            ::||..||                |.:.|   .|....|     :|.|..::..|.:|||:|||.
  Fly   363 IADLPRYPWMTLTDWMGSPFERVVCGDFN---GPNGCPR-----RRGRQTYTRFQTLELEKEFHF 419

  Fly    65 NKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDD 129
            |.||.|.|||||:..|.|||||:|||||||||||||.         |.....::.|:..|.::.:
  Fly   420 NHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE---------LRAVKEINEQARRDREEQE 475

  Fly   130 QI-VERLLRYANTNVETAPLRQ 150
            :: .:..::.|..|.:....:|
  Fly   476 KMKAQETMKSAQQNKQVQQQQQ 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/53 (64%)
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 34/52 (65%)
Abdominal-A 456..478 CDD:289192 3/31 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129372131
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.