DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and abd-A

DIOPT Version :9

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster


Alignment Length:152 Identity:51/152 - (33%)
Similarity:74/152 - (48%) Gaps:34/152 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VSDLMMYP----------------CVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHL 64
            ::||..||                |.:.|   .|....|     :|.|..::..|.:|||:|||.
  Fly   363 IADLPRYPWMTLTDWMGSPFERVVCGDFN---GPNGCPR-----RRGRQTYTRFQTLELEKEFHF 419

  Fly    65 NKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDD 129
            |.||.|.|||||:..|.|||||:|||||||||||||.         |.....::.|:..|.::.:
  Fly   420 NHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE---------LRAVKEINEQARRDREEQE 475

  Fly   130 QI-VERLLRYANTNVETAPLRQ 150
            :: .:..::.|..|.:....:|
  Fly   476 KMKAQETMKSAQQNKQVQQQQQ 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/52 (63%)
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 33/51 (65%)
Abdominal-A 456..478 CDD:289192 3/30 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439747
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.