powered by:
                   
 
    
    
             
          
            Protein Alignment zen2 and abd-A
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_476794.1 | Gene: | zen2 / 40827 | FlyBaseID: | FBgn0004054 | Length: | 252 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 152 | Identity: | 51/152 - (33%) | 
          
            | Similarity: | 74/152 -  (48%) | Gaps: | 34/152 - (22%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    16 VSDLMMYP----------------CVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHL 64::||..||                |.:.|   .|....|     :|.|..::..|.:|||:|||.
 Fly   363 IADLPRYPWMTLTDWMGSPFERVVCGDFN---GPNGCPR-----RRGRQTYTRFQTLELEKEFHF 419
 
 
  Fly    65 NKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDD 129|.||.|.|||||:..|.|||||:|||||||||||||.         |.....::.|:..|.::.:
 Fly   420 NHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE---------LRAVKEINEQARRDREEQE 475
 
 
  Fly   130 QI-VERLLRYANTNVETAPLRQ 150:: .:..::.|..|.:....:|
 Fly   476 KMKAQETMKSAQQNKQVQQQQQ 497
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45439747 | 
          
            | Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I4196 | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E2759_KOG0489 | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0000007 | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 5 | 4.740 |  | 
        
      
           
             Return to query results.
             Submit another query.