DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Antp

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:70 Identity:40/70 - (57%)
Similarity:50/70 - (71%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105
            ::.||.|..::..|.:|||:|||.|:||.|.|||||:..|.|||||:||||||||||.||....|
  Fly   295 QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359

  Fly   106 GAIGA 110
            |..|:
  Fly   360 GEPGS 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 35/55 (64%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/10 (30%)
Homeodomain 298..354 CDD:459649 35/55 (64%)

Return to query results.
Submit another query.