powered by:
Protein Alignment zen2 and Antp
DIOPT Version :9
Sequence 1: | NP_476794.1 |
Gene: | zen2 / 40827 |
FlyBaseID: | FBgn0004054 |
Length: | 252 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_996167.1 |
Gene: | Antp / 40835 |
FlyBaseID: | FBgn0260642 |
Length: | 378 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 40/70 - (57%) |
Similarity: | 50/70 - (71%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 EKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105
::.||.|..::..|.:|||:|||.|:||.|.|||||:..|.|||||:||||||||||.||....|
Fly 295 QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
Fly 106 GAIGA 110
|..|:
Fly 360 GEPGS 364
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
|
5 | 4.810 |
|
Return to query results.
Submit another query.