| Sequence 1: | NP_476794.1 | Gene: | zen2 / 40827 | FlyBaseID: | FBgn0004054 | Length: | 252 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001009885.1 | Gene: | mnx1 / 405399 | ZFINID: | ZDB-GENE-040409-1 | Length: | 311 | Species: | Danio rerio |
| Alignment Length: | 198 | Identity: | 59/198 - (29%) |
|---|---|---|---|
| Similarity: | 99/198 - (50%) | Gaps: | 48/198 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 IQSENYFVDNY---SVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLN 65
Fly 66 KYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSED------ 124
Fly 125 ---------LQKDDQIVE-----RLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYDYLHEFS 175
Fly 176 PEP 178 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| zen2 | NP_476794.1 | Homeobox | 46..99 | CDD:278475 | 35/52 (67%) |
| mnx1 | NP_001009885.1 | Homeobox | 180..233 | CDD:278475 | 35/52 (67%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||