DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and CG4328

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster


Alignment Length:219 Identity:49/219 - (22%)
Similarity:79/219 - (36%) Gaps:70/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNR---- 104
            ||.||..::.|....:..|.::....|..|..:::...|:.|.|::||||:|.|:||...:    
  Fly   342 KRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQE 406

  Fly   105 ---KGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQ 166
               |||..        |..|.|.|  |..:..::...|:::              .|.|:..||.
  Fly   407 PPSKGASD--------SQDSQESL--DSSLATKIKDEAHSD--------------SESQLESPYS 447

  Fly   167 -SYDYLHE----FSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHNTQDQPMIQNFCW 226
             :.|.|..    ...|.   .|:|||..:.|              .||.   |...:|::     
  Fly   448 TTSDGLTRMRCTIKDEQ---EQVPFNCMETN--------------KENC---NKNSEPIL----- 487

  Fly   227 DSNSSSASSSDILDVDYDFIQNLL 250
                     :.||.:.|...|.|:
  Fly   488 ---------NTILGLSYATFQQLM 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 17/55 (31%)
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757
LIM 259..313 CDD:413332
COG5576 <332..439 CDD:227863 28/120 (23%)
HOX 341..393 CDD:197696 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.