DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and vax2

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_919390.1 Gene:vax2 / 373869 ZFINID:ZDB-GENE-030904-8 Length:307 Species:Danio rerio


Alignment Length:183 Identity:54/183 - (29%)
Similarity:81/183 - (44%) Gaps:61/183 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLK----KS 101
            ::.||:||:|::.||..||.||...:|:....|.|::::|.|:|.|||:||||||.|.|    |.
Zfish   101 DRPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQTKD 165

  Fly   102 TNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQI----T 162
            |:::            ||.:||.|             |..|:    ||     :||:|::    .
Zfish   166 TDKR------------SSSTSESL-------------ATCNI----LR-----LLEQGRLLSVPA 196

  Fly   163 PPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHNT 215
            ||           |.|:.....|.|       .|.|| .|::..:..|....|
Zfish   197 PP-----------PNPLLAHPHPGN-------GSLLG-SPSVSTSSGVSSSTT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 28/59 (47%)
vax2NP_919390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Homeodomain 104..160 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..175 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..254 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.