DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hlx

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001071142.1 Gene:Hlx / 364069 RGDID:1311961 Length:476 Species:Rattus norvegicus


Alignment Length:115 Identity:36/115 - (31%)
Similarity:53/115 - (46%) Gaps:18/115 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQ 78
            :...|....|...|..:..|....|   |...||..||:||...||:.|.:.||:.:..|.:::.
  Rat   247 HQFQDTFPGPYAVLTKDTMPQTYKR---KRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLAA 308

  Fly    79 RLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKD 128
            .|.||:.|||:||||||||.:.|.               .:|:.:|..|:
  Rat   309 MLGLTDAQVKVWFQNRRMKWRHSK---------------EAQAQKDKDKE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 26/55 (47%)
HlxNP_001071142.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..170
Homeodomain 270..330 CDD:459649 28/62 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..401 4/31 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..476
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.