DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and Meox1

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_008766312.1 Gene:Meox1 RGDID:1308911 Length:328 Species:Rattus norvegicus

Alignment Length:204 Identity:38/205 (19%)
Similarity:63/205 (31%) Gaps:43/205 (21%)


  Fly    24 CVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVK 88
            |:.|...|..|....|..|.:||.      |.:..|.|..:......:.|:.       |....:
  Rat   132 CMVLGTIAHETEKKLSRRKKERSG------QSVVPEPENEVEACEGGSARVP-------TGAGPR 183

  Fly    89 IW----FQNRRMKLKKSTNRK----------GAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYA 139
            .|    |...|::..|..|::          .....||:|.|..:..:..             |.
  Rat   184 GWRLCSFSEFRVRCSKDQNQERLNERPFQLPPPTPTLTSSGPTQAACAHS-------------YV 235

  Fly   140 NTNVETAPLRQVDHGVLE-EGQITPPYQSYDYLHEF--SPEPMALPQLPFNEFDANWASSWLGLE 201
            :..:.:........|:.: ...::.|:......|..  |..|..|.......:|..:..|||...
  Rat   236 DVKLPSVGALNFPEGLAQHRPSLSSPFPRASIFHTLLNSTGPSGLGNSRNRTWDTLFWVSWLLPT 300

  Fly   202 PTIPIAENV 210
            ||||:...|
  Rat   301 PTIPLLHQV 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 9/57 (16%)
Meox1XP_008766312.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.