DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and pnx

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:78 Identity:38/78 - (48%)
Similarity:46/78 - (58%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AAPTATTRSSE--KSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQN 93
            :||.....|:.  ||||.||||:..||..|||.|..:.||:...|..|:..|.|:|.||||||||
Zfish    53 SAPNIANASAAKVKSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLSETQVKIWFQN 117

  Fly    94 RRMKLKKSTNRKG 106
            ||.|.||..:..|
Zfish   118 RRTKWKKELDGHG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 30/55 (55%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 3/9 (33%)
Homeodomain 68..124 CDD:459649 30/55 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.