DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and hoxc3a

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio

Alignment Length:169 Identity:61/170 (36%)
Similarity:82/170 (48%) Gaps:38/170 (22%)


  Fly     3 AIQSENYFVDNYSVSDLMMYPCVELNVEAAPT-------------------ATTRSSEKSKRSRT 48
            |::.|.....:.|....|.||.  :....|||                   |..|:| .|||:|.
Zfish   102 ALEREKACELSTSCLSTMKYPW--MRETHAPTHFSSINAMESGDSKYSNGEAVVRNS-SSKRARV 163

  Fly    49 AFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTT 113
            ||:|.||:|||:|||.:.||.|.||:|:::.|.||:||:||||||||||.||....|        
Zfish   164 AFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEK-------- 220

  Fly   114 SIPLSSQSSEDLQKDDQIVERL-------LRYANTNVET 145
            |...||.:....:....|:.|.       |::.| |.||
Zfish   221 STAKSSYTYLGTENQPLIISRSTTDSPVPLKFQN-NYET 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/53 (62%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 50/134 (37%)
Homeobox 162..214 CDD:306543 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45664
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.