DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Gbx1

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_056554.1 Gene:Gbx1 / 231044 MGIID:95667 Length:418 Species:Mus musculus


Alignment Length:129 Identity:53/129 - (41%)
Similarity:74/129 - (57%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EAAPTAT--TRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQ 92
            |..|.||  |....||:|.||||:|.||:|||:|||..|||:.|.|.:|:..|.|:|.|||||||
Mouse   301 EGTPVATGVTTPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQ 365

  Fly    93 NRRMKLK--KSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHG 154
            |||.|.|  |:.|             :||:|.|.: ::.:||..:..:.|.....:..:|::.|
Mouse   366 NRRAKWKRIKAGN-------------VSSRSGEPV-RNPKIVVPIPVHVNRFAVRSQHQQMEQG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 35/57 (61%)
Gbx1NP_056554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..320 8/18 (44%)
Homeodomain 317..373 CDD:459649 34/55 (62%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.