DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxc6

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006520531.1 Gene:Hoxc6 / 15425 MGIID:96197 Length:243 Species:Mus musculus


Alignment Length:92 Identity:44/92 - (47%)
Similarity:58/92 - (63%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTN----- 103
            :|.|..:|..|.:|||:|||.|:||.|.|||||:..|.|||||:||||||||||.||.:|     
Mouse   150 RRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTL 214

  Fly   104 RKGAIGALTTSIPLSSQSSEDLQKDDQ 130
            ..|..||...|:....:..|:.:::.|
Mouse   215 SGGGGGATADSLGGKEEKREETEEEKQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 35/55 (64%)
Hoxc6XP_006520531.1 Homeodomain 150..206 CDD:459649 35/55 (64%)

Return to query results.
Submit another query.