DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxc5

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_783857.1 Gene:Hoxc5 / 15424 MGIID:96196 Length:222 Species:Mus musculus


Alignment Length:62 Identity:39/62 - (62%)
Similarity:48/62 - (77%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK 105
            |||||:::..|.:|||:|||.|:||.|.|||||:..|.|.|||:||||||||||.||.:..|
Mouse   156 KRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 36/55 (65%)
Hoxc5NP_783857.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141
Antp-type hexapeptide 140..145
Homeodomain 156..212 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.