DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxb9

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_032296.2 Gene:Hoxb9 / 15417 MGIID:96190 Length:250 Species:Mus musculus


Alignment Length:74 Identity:36/74 - (48%)
Similarity:50/74 - (67%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMK 97
            |:|....:..|::.|..::..|.:|||:||..|.||.|.||.|:::.|.|:||||||||||||||
Mouse   175 PSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMK 239

  Fly    98 LKKSTNRKG 106
            :||....:|
Mouse   240 MKKMNKEQG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 30/55 (55%)
Hoxb9NP_032296.2 Hox9_act 1..172 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..182 2/6 (33%)
Homeodomain 186..242 CDD:459649 30/55 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.