DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxa2

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034581.1 Gene:Hoxa2 / 15399 MGIID:96174 Length:372 Species:Mus musculus


Alignment Length:253 Identity:74/253 - (29%)
Similarity:116/253 - (45%) Gaps:71/253 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST----- 102
            |:|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.|     
Mouse   139 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKEN 203

  Fly   103 -NRKGAIGALTTSIPLSSQSSEDLQKDDQ---IVERLLRYANTNVE---------TAPLRQVDHG 154
             |.:|....|        :.|:.:::|::   :.|:.|..:...:|         ....:|..:|
Mouse   204 QNSEGKFKNL--------EDSDKVEEDEEEKSLFEQALSVSGALLEREGYTFQQNALSQQQAPNG 260

  Fly   155 VLEEGQITP--PYQSYDY--------------------------LHEFSPEPMALPQL-PFNEFD 190
            ...:.|..|  |..|.:.                          |:..|||.:.:|.| .||.|.
Mouse   261 HNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEAIEVPSLQDFNVFS 325

  Fly   191 ANWASSWL----GLEPTIPIAENVIEHNTQDQPM-IQNFCWDSNSSSASSSDILDVDY 243
            .:   |.|    .|.|::|        .:.|.|: |....:|..:.:.::.|:..::|
Mouse   326 TD---SCLQLSDALSPSLP--------GSLDSPVDISADSFDFFTDTLTTIDLQHLNY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 37/55 (67%)
Hoxa2NP_034581.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
Antp-type hexapeptide 96..101
Homeodomain 140..196 CDD:459649 37/55 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..225 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.