DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zen2 and Hoxa11

DIOPT Version :10

Sequence 1:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_034580.1 Gene:Hoxa11 / 15396 MGIID:96172 Length:313 Species:Mus musculus


Alignment Length:60 Identity:29/60 - (48%)
Similarity:46/60 - (76%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK 100
            :::::.|..::..|:.||||||..:.|:.:.:|:::|:.|.||:|||||||||||||.||
Mouse   239 QRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 27/55 (49%)
Hoxa11NP_034580.1 DUF3528 26..154 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..246 0/6 (0%)
Homeodomain 242..298 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.