DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and Hoxb2

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_598793.2 Gene:Hoxb2 MGIID:96183 Length:354 Species:Mus musculus

Alignment Length:205 Identity:69/206 (33%)
Similarity:91/206 (44%) Gaps:34/206 (17%)


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK-- 105
            |:|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.|..:  
Mouse   141 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREP 205

  Fly   106 --GAIGALTTSIPLSSQSSEDLQKDDQIVERLLR-------YANTNVETAPLRQVDHGVLEEGQI 161
              |..|..:........:.|.......:....||       .|......||...:....||....
Mouse   206 PEGEPGGPSAQDDAGEPAEEPTVSPGDVATHRLREACFHPAEAAQGPRGAPPSALPATTLESVGA 270

  Fly   162 TPP---------YQSYDYLHEFSPEPMALPQLPFNEFDANWASSWL----GLEPT--------IP 205
            :.|         .||.....:..||....|.||...|.|  |.|.|    ||.|:        :|
Mouse   271 SSPGCTMLRAGGRQSEPLPEDACPERQDSPFLPDLNFFA--ADSCLQMSGGLSPSLQGSLDSPVP 333

  Fly   206 IAENVIEHNT 215
            .:|..::..|
Mouse   334 FSEEELDFFT 343

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/53 (68%)
Hoxb2NP_598793.2 Antp-type hexapeptide 92..97
Homeobox 145..197 CDD:278475 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.