DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and Hoxb2

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_002724587.1 Gene:Hoxb2 RGDID:2319509 Length:355 Species:Rattus norvegicus

Alignment Length:209 Identity:69/210 (33%)
Similarity:93/210 (44%) Gaps:42/210 (20%)


  Fly    43 SKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRK-- 105
            |:|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||||.|:.|..:  
  Rat   142 SRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREP 206

  Fly   106 --GAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYA--------------------NTNVETAPL 148
              |..|.|:........:.|.......:....||.|                    .|.:|:...
  Rat   207 PDGEPGGLSAQDDAGEPAEEPTVSPGDVASHRLREACFLPAEAAQGPRGAPPPLPPATALESVGA 271

  Fly   149 RQVDHGVLEEGQITPPYQSYDYLHEFSPEPMALPQLPFNEFDANWASSWL----GLEPT------ 203
            ......:|..|.:    ||.....:..||....|.||...|.|  |.|.|    ||.|:      
  Rat   272 SSPGCTMLRAGGL----QSEPLPEDACPERQDSPFLPDLNFFA--ADSCLPMSGGLSPSLQGSLD 330

  Fly   204 --IPIAENVIEHNT 215
              :|.:|..::..|
  Rat   331 SPVPFSEEELDFFT 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/53 (68%)
Hoxb2XP_002724587.1 Homeobox 146..198 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.