DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and LOC100360577

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_002729358.1 Gene:LOC100360577 RGDID:2321880 Length:285 Species:Rattus norvegicus

Alignment Length:81 Identity:42/82 (51%)
Similarity:59/82 (72%) Gaps:1/82 (1%)


  Fly    20 MMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTE 84
            ::||.:: .:..:....:.:..:.||||||::..|::|||:|||.|:||.|.|||||:..|.|:|
  Rat   158 VVYPWMK-KIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSE 221

  Fly    85 RQVKIWFQNRRMKLKK 100
            |||||||||||||.||
  Rat   222 RQVKIWFQNRRMKWKK 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/53 (68%)
LOC100360577XP_002729358.1 Homeobox 183..236 CDD:278475 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.