DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and meox2

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001116898.1 Gene:meox2 XenbaseID:XB-GENE-852818 Length:300 Species:Xenopus tropicalis

Alignment Length:98 Identity:44/99 (44%)
Similarity:58/99 (59%) Gaps:11/99 (11%)


  Fly    40 SEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK---- 100
            :.|.::.||||:..|:.|||.||..:.||.|.||.||:..|.|||||||:||||||||.|:    
 Frog   180 NSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGG 244

  Fly   101 ---STNRKGAIGALT--TSIP--LSSQSSEDLQ 126
               :..|:..:|.:.  |.:|  ||...|..||
 Frog   245 QQGAAAREKELGNVKKGTLLPSELSGIRSSSLQ 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 33/53 (62%)
meox2NP_001116898.1 COG5576 157..269 CDD:227863 40/89 (45%)
Homeobox 187..239 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.