DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zen2 and hoxb2

Sequence 1:NP_476794.1 Gene:zen2 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_002938064.2 Gene:hoxb2 XenbaseID:XB-GENE-478525 Length:436 Species:Xenopus tropicalis

Alignment Length:257 Identity:76/258 (29%)
Similarity:105/258 (41%) Gaps:84/258 (33%)


  Fly    31 AAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRR 95
            |.|.....:...|:|.|||:::.||:|||:|||.||||.|.||:||:..|.|||||||:||||||
 Frog   217 AEPPGLHDAGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRR 281

  Fly    96 MKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQ 160
            ||.|:.|..|            .||..|              ::.:|.|       |...|::|.
 Frog   282 MKHKRQTQHK------------DSQDGE--------------HSYSNPE-------DGEPLDDGD 313

  Fly   161 ITPPY----QSYDYL--HEFSPEP-MALPQLPFNEFDANWASSWLGLEPTIPI------------ 206
            .:|.|    .|.|.|  .|...:| .|:|             |...|.|:.|:            
 Frog   314 DSPVYHQGLDSNDSLREQEIRKDPSTAMP-------------SSKELTPSSPLYPTPTTDSEGRI 365

  Fly   207 ----AENVIEHNTQDQPMIQNFCWDSNSSSASSSD--------------ILDVDYDFIQNLL 250
                .:||:. .|.|..::......|:.|....||              ..:.|.||:.:.|
 Frog   366 EVGSMDNVLS-QTPDNSLLSELTLFSSDSCLHISDGITSLHGSLHSPVHFSEEDIDFLTSTL 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zen2NP_476794.1 Homeobox 46..99 CDD:278475 36/53 (68%)
hoxb2XP_002938064.2 Homeobox 233..285 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.