DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and NANOGP8

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001342210.1 Gene:NANOGP8 / 388112 HGNCID:23106 Length:305 Species:Homo sapiens


Alignment Length:182 Identity:54/182 - (29%)
Similarity:87/182 - (47%) Gaps:14/182 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VPQTPDGMD-SVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLP---RRLRTAYTNTQLLE 212
            |...|..|| .:.:.|   :..||.|.....: .:||:.:  .|:.:|   ::.||.:::|||..
Human    51 VSPLPSSMDLLIQDSP---DSSTSPKGKQPTS-AENSVAK--KEDKVPVKKQKTRTVFSSTQLCV 109

  Fly   213 LEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQS 277
            |...|...|||...:..|::..|:|:.:|||.||||:|||.||...:......|..:.|......
Human   110 LNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTY 174

  Fly   278 DSNSNSKKSCQGCEL-PSDDIPDSTSNSRGHNNNTPSATNNNPSAGNLTPNS 328
            .|..:|..  |||.: |:.::| ..||...:|:...:.|.|..|..|.:.|:
Human   175 PSLYSSYH--QGCLVNPTGNLP-MWSNQTWNNSTWSNQTQNIQSWSNHSWNT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 23/55 (42%)
NANOGP8NP_001342210.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 12/50 (24%)
Homeodomain 97..152 CDD:459649 23/54 (43%)
8 X repeats starting with a Trp in each unit 196..240 8/28 (29%)
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240 8/28 (29%)
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.