DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and DLX3

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_005211.1 Gene:DLX3 / 1747 HGNCID:2916 Length:287 Species:Homo sapiens


Alignment Length:152 Identity:51/152 - (33%)
Similarity:73/152 - (48%) Gaps:24/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 NGLPRRL---RTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQ 256
            ||.|:::   ||.|::.||..|::.|...:||..|.|.|:||.|.||:.|||:||||||.|.|: 
Human   123 NGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK- 186

  Fly   257 TLSKTDD------EDNKDSLKGDDDQS----DSNSNSKKSCQGCELP-------SDDIPDSTSNS 304
             |.|..:      .:|.||:..:...|    |::|:|..:....:||       |....|..:||
Human   187 -LYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNS 250

  Fly   305 RGHNNNT--PSATNNNPSAGNL 324
            ..|..|.  |......|....|
Human   251 WYHAQNLSGPHLQQQPPQPATL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 27/58 (47%)
DLX3NP_005211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
DLL_N 27..107 CDD:463567
COG5576 <109..232 CDD:227863 40/110 (36%)
homeobox 129..188 28/60 (47%)
Homeodomain 130..186 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..287 18/78 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.