DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Lcp65Ab2

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_788469.1 Gene:Lcp65Ab2 / 48381 FlyBaseID:FBgn0020643 Length:104 Species:Drosophila melanogaster


Alignment Length:100 Identity:31/100 - (31%)
Similarity:49/100 - (49%) Gaps:16/100 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AVAHAQPVLAKAAEEY-DPHPQYKYAYDVQDS------LSGDSKSQVEERDGDVVRGEYSLID-A 97
            |:|.|:|.||:...:. |..|: |::.||:.|      ..|..|:...:.:..||.|.::.:| .
  Fly    12 AMAVARPNLAEIVRQVSDVEPE-KWSSDVETSDGTSIKQEGVLKNAGTDNEAAVVHGSFTWVDEK 75

  Fly    98 DGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPV 132
            .|.|.|:.|.||. ||:      :|....:.||||
  Fly    76 TGEKFTITYVADE-NGY------QPQGAHLPVAPV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 17/58 (29%)
Lcp65Ab2NP_788469.1 Chitin_bind_4 40..91 CDD:459790 14/51 (27%)

Return to query results.
Submit another query.