DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Lcp65Af

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:134 Identity:37/134 - (27%)
Similarity:52/134 - (38%) Gaps:45/134 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHP-QYKYAYDV 68
            |:|||||                             |||..|.:    .:|.|..| .:.|.|:.
  Fly     7 FVALFAL-----------------------------AVADVQIL----KQESDVGPVSFNYGYET 38

  Fly    69 QDSLSGDSKSQVEERDGDV----VRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAV 129
            .|..|..:..|::....|.    |:|.||.:..||...::.||||. ||:      :|....:.|
  Fly    39 SDGSSAQAAGQLKNVGTDEEALNVKGTYSFVADDGQTYSIAYTADE-NGY------QPQGAHLPV 96

  Fly   130 APVV 133
            ||||
  Fly    97 APVV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 17/55 (31%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.