DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr100A

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:213 Identity:59/213 - (27%)
Similarity:78/213 - (36%) Gaps:53/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYD 67
            |:|:||..|:|.||:      |.||..|..|       |:...|..|:...       ::..||:
  Fly     2 FRFLALTTLVALASS------QHYHQDPKTA-------AIISEQRYLSGDG-------KFGAAYE 46

  Fly    68 VQDSLSGDSKSQVEERDGDVVR-GEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAP 131
            .:|.::..     ||.|.|..| |.||.:|..|.:||:.|||.. |||.|..:..|........|
  Fly    47 QEDGINFK-----EETDADGTRHGSYSYLDPTGQRRTISYTAGK-NGFQASGDHLPQAPPAPPQP 105

  Fly   132 VVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVA---------------HYAAPAVVKTVAPVAHY 181
            |......|...|..   ..|.|||    ..|.|               .|..|:..:.   ...|
  Fly   106 VPTAGYQPQQQYQP---QQYQAPA----PQPQASFRSNDYGDDGSYDPRYNDPSFGQN---QQSY 160

  Fly   182 AAPATYTSY-AAPAVAYH 198
            ..||....| .||..||:
  Fly   161 QQPAAQPQYRPAPQPAYN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 19/52 (37%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 19/49 (39%)

Return to query results.
Submit another query.