DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:206 Identity:168/206 - (81%)
Similarity:177/206 - (85%) Gaps:10/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFIALFALIAAASAGVLPV--QQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYK 63
            |||||:...|.:|.||||..|:  .|||||||||||||.|||||  ||.|:.||||||||||||:
  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAV--AQKVVVKAAEEYDPHPQYR 63

  Fly    64 YAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVA 128
            ::|.|.|.|:||:|.||||||||||||||||||||||||.|||||||||||||||||||||||||
  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVA 128

  Fly   129 VAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPATY------ 187
            |||||||||||||.|||||||||||||||||||||||||||||||||||||||||||.|      
  Fly   129 VAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYATYAAP 193

  Fly   188 TSYAAPAVAYH 198
            |.|||||||||
  Fly   194 THYAAPAVAYH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 41/51 (80%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 41/51 (80%)

Return to query results.
Submit another query.