DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Edg84A

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_524247.1 Gene:Edg84A / 40818 FlyBaseID:FBgn0000552 Length:188 Species:Drosophila melanogaster


Alignment Length:172 Identity:79/172 - (45%)
Similarity:101/172 - (58%) Gaps:18/172 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VAVAHAQPVLAKAA---EEYDPHPQYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYK 101
            :.:|.|.|:.||::   :.||.||||.:.|||||..:||.|||.|.||||||.|:||:.|||||:
  Fly    12 IGLAQAGPLPAKSSGSEDTYDSHPQYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYR 76

  Fly   102 RTVQYTADPINGFNAVVNREPL------VKAVAVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTV 160
            |||.||||.:.||||||.||||      ||..|.|.|.|....|:....|......|:..|.::.
  Fly    77 RTVDYTADDVRGFNAVVRREPLSSAAVVVKPQATAVVPKVQLKPLKKLPALKPLSQASAVVHRSF 141

  Fly   161 APVAHYAAPAVVKTVAPVAHYAAPA-TYTSYAAPAV--AYHH 199
            |||.|:|      .|..|.|:|||| ::.|:..|.:  ..||
  Fly   142 APVVHHA------PVTHVVHHAAPAHSFVSHHVPVLKTTVHH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 33/51 (65%)
Edg84ANP_524247.1 Chitin_bind_4 37..89 CDD:459790 33/51 (65%)

Return to query results.
Submit another query.