DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr76Bd

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:117 Identity:54/117 - (46%)
Similarity:68/117 - (58%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YHAAPAV-ATYAQAPVAVA----------HA--QPVLAKAAEEYDPHPQYKYAYDVQDSLSGDSK 77
            |..||:| |..:.||||..          ||  :.|..|..|.:|.||:|.:.|.|.|..:||:|
  Fly  1107 YRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNK 1171

  Fly    78 SQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNA-VVNREPLVKAVA 128
            .|.||||||||:|||||::.||..|||:|.||...||:| |:|.....|.||
  Fly  1172 HQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEVINSRDQGKIVA 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.