DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr67Fa2

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster


Alignment Length:147 Identity:34/147 - (23%)
Similarity:56/147 - (38%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSL 72
            :|..:..|||       |...|...|||.|      .|...:.|...:..|...|.|.|:..:.:
  Fly     1 MFRYMLVASA-------VLACAYGAATYNQ------EAGAYITKIGSDIQPEGNYNYQYETSNGI 52

  Fly    73 SGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGF---NAVVNREPLVKAVAVAPV-- 132
            :    :|.....|:...|.:|....:|....:.|.||. ||:   .|::...|.:.|..:..:  
  Fly    53 A----AQESGIGGNHANGGFSWYSPEGELVQISYVADE-NGYQPQGALLPTPPPIPAAILRSLEY 112

  Fly   133 VKTVAAPV-AHYAAPAV 148
            ::|....| ..|..||:
  Fly   113 IRTHPQYVEQEYRRPAL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 12/51 (24%)
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:459790 12/51 (24%)

Return to query results.
Submit another query.