DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr65Ec

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:132 Identity:27/132 - (20%)
Similarity:39/132 - (29%) Gaps:54/132 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AQAPVAVAHAQPVLAKAAEEYDPHPQ-------------YKYAYDVQDSLSGDSKSQVEERDGDV 87
            |.|.:||:..|      |:.:|...:             |.|.|...:.::|    |.....|..
  Fly     8 AVAALAVSCVQ------ADSFDARAETREYKSDLKEDGSYAYQYQTSNGIAG----QESGVGGYY 62

  Fly    88 VRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVAAPVAHYAAPAVAHYA 152
            ..|..:....||....:.||||. ||::                              ||.||..
  Fly    63 ASGSNAYYAPDGQLIQLTYTADS-NGYH------------------------------PAGAHLP 96

  Fly   153 AP 154
            .|
  Fly    97 TP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 14/51 (27%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:459790 14/51 (27%)

Return to query results.
Submit another query.