DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr65Ea

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:61 Identity:22/61 - (36%)
Similarity:29/61 - (47%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YAYDVQDSLSGDSKSQVEERD--GDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREP 122
            ||||::.:    |..|::|..  |....|.||.|..:|....|.||||.. ||:...|..|
  Fly    37 YAYDIEQA----SGIQIKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEF-GFHPQSNLLP 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 18/51 (35%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 18/51 (35%)

Return to query results.
Submit another query.