DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:164 Identity:67/164 - (40%)
Similarity:89/164 - (54%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IAAASAGVLPVQQVYHAAPAVATYA----QAPVAVAHAQPVLAKAAEEYDPHPQYKYAYDVQDSL 72
            |:.|:..:|....:.:||||: :||    .||||||.     ...||.|||:|||.::|.|.|..
  Fly    44 ISYAAPKLLAAPAISYAAPAI-SYAPKVLAAPVAVAK-----VAVAEPYDPNPQYSFSYGVTDHH 102

  Fly    73 SGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVA 137
            :||||.|.|.....||.|.|||.:.||..|.|.||||.:|||||||.::. |.|||:        
  Fly   103 TGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKG-VAAVAI-------- 158

  Fly   138 APVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAV 171
                  |.||:|..|.||:.|    :.:.:||.:
  Fly   159 ------AKPALAVAAVPAITK----IGYASAPGL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 25/51 (49%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 25/51 (49%)

Return to query results.
Submit another query.