DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:142 Identity:73/142 - (51%)
Similarity:84/142 - (59%) Gaps:26/142 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFIALF--ALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLAKAAEEYDPHPQYK 63
            ||...|.|.  |||||....:||.                      |.||......|.||||||.
  Fly     1 MALIKITLICCALIAAIECALLPA----------------------AVPVGVPLNTEVDPHPQYA 43

  Fly    64 YAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVA 128
            :||:|||:|:||||||.|.||||||:|.||::||||..|||.|||||||||||||.|.|:  .||
  Fly    44 FAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPV--PVA 106

  Fly   129 VAPVVKTVAAPV 140
            ..|:|..||||:
  Fly   107 ARPLVAPVAAPI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 37/51 (73%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 37/51 (73%)

Return to query results.
Submit another query.