DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ad and Cpr56F

DIOPT Version :10

Sequence 1:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:186 Identity:47/186 - (25%)
Similarity:65/186 - (34%) Gaps:68/186 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQ----------------------------- 37
            ||..|||...:||.:....||.|..:..|..:..|.                             
  Fly     3 AFTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQSPSSNYLPPQRAGGNGG 67

  Fly    38 -------APVAVAHAQ---PVLAKA---------------------------AEEYDPHPQYKYA 65
                   ||:|....|   |.|..|                           .|:|.| .:|::.
  Fly    68 APSNSYGAPIAPPQGQYGAPALTGAIFKGGNGNGNGGYGGGNGNGNGYGQRDEEQYGP-AKYEFK 131

  Fly    66 YDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE 121
            |||||..||:....:|.||||:..|.|.::..||.|:.|:|.||. ||:...:..|
  Fly   132 YDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ-NGYRPTIRYE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 23/51 (45%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 23/51 (45%)

Return to query results.
Submit another query.